PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00031399-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB
Protein Properties Length: 343aa    MW: 38274.2 Da    PI: 6.5088
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00031399-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+W +eEd++lv++++++G ++W++ ++  g++R++k+c++rw +yl
  WALNUT_00031399-RA 14 KGPWAPEEDQKLVKYIQKHGHESWRALPKLAGLNRCGKSCRLRWINYL 61
                        79********************************************97 PP

2Myb_DNA-binding55.61.2e-1767112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg++++eE++ ++++++ lG++ W++Ia++++ gRt++++k++w+++l
  WALNUT_00031399-RA  67 RGKFSQEEEQTILNLHAVLGNK-WSAIASHLP-GRTDNEIKNFWNTHL 112
                         89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.386961IPR017930Myb domain
SuperFamilySSF466891.42E-3012108IPR009057Homeodomain-like
SMARTSM007176.8E-141363IPR001005SANT/Myb domain
PfamPF002492.5E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-241568IPR009057Homeodomain-like
CDDcd001677.74E-111661No hitNo description
PROSITE profilePS5129426.80162116IPR017930Myb domain
SMARTSM007175.9E-1766114IPR001005SANT/Myb domain
PfamPF002491.8E-1667112IPR001005SANT/Myb domain
CDDcd001671.50E-1269112No hitNo description
Gene3DG3DSA:1.10.10.603.3E-2869117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGRPPSCDES GQKKGPWAPE EDQKLVKYIQ KHGHESWRAL PKLAGLNRCG KSCRLRWINY  60
LRPDIKRGKF SQEEEQTILN LHAVLGNKWS AIASHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHRPRT DVFSSFSHLI AMANLKELLD HRSWEEQAVK LQAEAAVQMA ANLQYLQYLF  180
QPLASNGTTT NSINSFTTEM ETSTHLNLLS SIKDIDLGLS SSQLDTPTQS LVTSTLQPEH  240
DAVPFSHLPD LQIIPCSYET PLEKGSNVQA PKYTAFSLGE DSPNTPWLAS TSSNPSPNSV  300
VPPMTESSIN KLGDVCSTSS YGGAAPSFWP DLLLEDLLFH EFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-30141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011022802.11e-153PREDICTED: myb-related protein 308-like
TrEMBLB9H4T11e-152B9H4T1_POPTR; Uncharacterized protein
STRINGPOPTR_0005s07590.11e-152(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-100myb domain protein 93